« Back
Home /
Recombinant Human R-spondin-3 Protein

Recombinant Human R-spondin-3 Protein

Item no.	RP00439-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Category	Oncology Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
NCBI	R-spondin-3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RSPO3,CRISTIN1,PWTSR,THSD2
Similar products	CRISTIN1, PWTSR, THSD2
Shipping Condition	Cool pack
Available
Manufacturer - Category	Biosimilar Drug Targets
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human R-spondin-3 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Gln22-His272) of human R-spondin-3/RSPO3 (Accession #Q9BXY4) fused with an Fc, 6xHis tag at the C-terminus.
Background	This protein belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Immunogen	Gln22-His272
Route	C-Fc&His
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH7.2.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00439-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer