« Zurück
Startseite /
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

ArtNr	RP00479-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	1000 ug 100 ug 10 ug 500 ug 50 ug
Kategorie	Oncology By Cell Type Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins By Organ Pancreatic Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE;> 95% by HPLC
Sequence	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
NCBI	Fc gamma RIIB/CD32b
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc gamma RII,Fc gamma RIIB,CD32,CD32b,CDw32,FCG2,IGFR2,CD32A,FCG2 ,FcGR,FCGR2,FCGR21,FCGR2A
Similar products	IFNA2, LeIF A, Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A
Lieferbar
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	22.5 kDa
Description	Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala46-Pro217) of Human Fc gamma RIIB/CD32b (Accession #P31994-1) fused with a C-His&Avi tag at the C-terminus.
Background	The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala46-Pro217
Route	C-His&Avi
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	22.5 kDa
Gene Symbol	Fc gamma RIIB/CD32b

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00479-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern