Vergleich

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein Europäischer Partner

ArtNr RP00479-500ug
Hersteller Abclonal
Menge 500 ug
Quantity options 1000 ug 100 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE;> 95% by HPLC
NCBI Fc gamma RIIB/CD32b
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc gamma RII,Fc gamma RIIB,CD32,CD32b,CDw32,FCG2,IGFR2,CD32A,FCG2 ,FcGR,FCGR2,FCGR21,FCGR2A
Similar products IFNA2, LeIF A, Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
22.5 kDa
Description
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala46-Pro217) of Human Fc gamma RIIB/CD32b (Accession #P31994-1) fused with a C-His&Avi tag at the C-terminus.
Background
The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala46-Pro217
Route
C-His&Avi
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Revised name
Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
Antigen Seq
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
22.5 kDa
Gene Symbol
Fc gamma RIIB/CD32b

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen