Recombinant Human BST-1/CD157 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

The cluster of differentiation (CD) system is a glycosyl phosphatidylinositol anchored membrane protein thatbelongs to the CD38 family.It is generally used in immunophynotyping. CD157 was discovered in a bonemarrow stromal cell line where it facilitates pre-B-cell growth. CD157 is a bifunctional ectoenzyme that exhibitsboth ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities followed with CD38. It plays a role inrheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Studieshave shown that this protein have a role in predicted to function as a cell surface receptor and animmunoregulatory molecule.

Gly29-Lys292

< 1 EU/μg of the protein by LAL method.

GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK

29.95 kDa