« Zurück
Startseite /
Recombinant Human BY55/CD160 Protein

Recombinant Human BY55/CD160 Protein

ArtNr	RP00566-1000ug
Hersteller	Abclonal
Menge	1000 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie	Oncology By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90% by SDS-PAGE.
NCBI	BY55/CD160
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD160,BY55,NK1,NK28
Similar products	CD160, BY55, CD160 Antigen, Natural Killer Cell Receptor BY55
Lieferbar
Manufacturer - Applications	<0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	15.64 kDa
Description	Recombinant Human CD160 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ile27-Ser159) of human CD160 (Accession #O95971) fused with a 6×His tag at the C-terminus.
Background	CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ile27-Ser159
Route	C-His
Manufacturer - Research Area	Bio-Markers & CD Antigens
Revised name	CD160 Antigen, Natural Killer Cell Receptor BY55, CD160, BY55
Antigen Seq	INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size	15.64 kDa
Gene Symbol	BY55/CD160

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00566-1000ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern