Vergleich

Recombinant Human BY55/CD160 Protein Europäischer Partner

ArtNr RP00566-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against Human (Homo sapiens)
Purity > 90% by SDS-PAGE.
NCBI BY55/CD160
Alias CD160,BY55,NK1,NK28
Lieferbar
Manufacturer - Applications
<0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
15.64 kDa
Description
Recombinant Human CD160 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ile27-Ser159) of human CD160 (Accession #O95971) fused with a 6×His tag at the C-terminus.
Background
CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ile27-Ser159
Route
C-His
Manufacturer - Research Area
Bio-Markers & CD Antigens
Antigen Seq
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
15.64 kDa
Gene Symbol
BY55/CD160

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen