« Zurück
Startseite /
Recombinant Human DAF/CD55 Protein

Recombinant Human DAF/CD55 Protein

ArtNr	RP00975-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLT
NCBI	DAF/CD55
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD55,CR,CROM,DAF,TC,CROM,DAF,TC
Similar products	CR, DAF, CROM, TC
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	35.80 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human CD55/DAF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp35-Ser353) of human CD55/DAF (Accession #NP_000565.1) fused with a 6×His tag at the C-terminus.
Background	This protein is a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM).
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Asp35-Ser353
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Bio-Markers & CD Antigens
Antigen Seq	DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTS
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Human DAF/CD55 at 0. 5 μg/mL (100 μL/well) can bind Human CD97 with a linear range of 0. 3-23. 8 ng/mL.\|2. Measured by its binding ability in a functional ELISA. Immobilized APC anti-human CD55 Antibody at 1 μg/mL (25 μL/well) can bind Recombinant Human CD55 with a linear range of 0. 5-3. 2 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	35.80 kDa
Gene Symbol	DAF/CD55

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00975-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern