Vergleich

Recombinant Human IGF-I Protein Europäischer Partner

ArtNr RP00996-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 87% by SDS-PAGE.
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
NCBI IGF-I
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IGF1,IGF-I,IGFI,MGF,IGFI,MGF
Similar products IGF-1, IGF1A, MGF, IGF-I, IGFI, IGF?I
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
34.44 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence ( Gly 49 - Ala 118) of human IGF1 (Accession #NP_001104755.1) fused with an Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gly49-Ala118
Route
C-hFc&His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor, Cell Culture related
Antigen Seq
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Bioactivity
1. Measured by its ability to stimulate p70 S6 Kinase(Thr389) and p85 S6 Kinase(Thr412) autophosphorylation in 293T human embryonic kidney cells. 0. 01-1 ng/mL of Recombinant Human IGF1 can effectively enhance p70 S6 Kinase(Thr389) and p85 S6 Kinase(Thr412) autophosphorylation.|2. Measured by its binding ability in a functional ELISA. Immobilized recombinant human IGFBP6 at 1 μg/mL (100 μL/well) can bind recombinant human IGF1 with a linear range of 30-250 ng/mL. 3. Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is typically 7. 5-30 ng/mL, corresponding to a specific activity of 3. 33×104-1. 33×105units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
34.44 kDa
Gene Symbol
IGF-I

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen