« Zurück
Startseite /
Recombinant Human IL-23/IL-12B&IL-23A Protein

Recombinant Human IL-23/IL-12B&IL-23A Protein

ArtNr	RP01160-5ug
Hersteller	Abclonal
Menge	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IL-12B&IL-23A
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-23 p19/IL-12 p40,IL23,SGRF ,IL-23 alpha & IL-12 beta
Similar products	SGRF, IL23, IL-23 p19/IL-12 p40, IL-23 alpha & IL-12 beta
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.50 kDa(IL-12A), 34.71 kDa(IL-12B)
Description	Active Recombinant Human IL-12B&IL-23A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328&Arg20-Pro189) of human IL-23 (Accession #NP_002178.2/NP_057668.1) fused with a 6×His tag at the N-terminus(IL23A).
Immunogen	Ile23-Ser328(IL12B)&Arg20-Pro189(IL23A)
Route	No tag(IL12B)&N-his(IL23A)
Manufacturer - Research Area	Interleukin
Revised name	IL-23 p19/IL-12 p40, IL23, SGRF , IL-23 alpha & IL-12 beta
Antigen Seq	IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS//RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Bioactivity	1. Measured by its binding ability in a functional ELISA.Immobilized Human IL-12B&IL-23A at 5μg/mL (100 μL/well) can bind Human IL23R with a linear range of 4-135 ng/ml.\|2. Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED₅₀ for this effect is 21. 23-84. 94 ng/mL, corresponding to a specific activity of 1. 17×10⁴~4. 71×10⁴ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	19.50 kDa(IL-12A), 34.71 kDa(IL-12B)
Gene Symbol	IL-12B&IL-23A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01160-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern