« Back
Home /
Recombinant Human IL-23/IL-12B&IL-23A Protein

Recombinant Human IL-23/IL-12B&IL-23A Protein

Item no.	RP01160-5ug
Manufacturer	Abclonal
Amount	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IL-12B&IL-23A
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-23 p19/IL-12 p40,IL23,SGRF ,IL-23 alpha & IL-12 beta
Similar products	SGRF, IL23, IL-23 p19/IL-12 p40, IL-23 alpha & IL-12 beta
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.50 kDa(IL-12A), 34.71 kDa(IL-12B)
Description	Active Recombinant Human IL-12B&IL-23A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328&Arg20-Pro189) of human IL-23 (Accession #NP_002178.2/NP_057668.1) fused with a 6×His tag at the N-terminus(IL23A).
Immunogen	Ile23-Ser328(IL12B)&Arg20-Pro189(IL23A)
Route	No tag(IL12B)&N-his(IL23A)
Manufacturer - Research Area	Interleukin
Revised name	IL-23 p19/IL-12 p40, IL23, SGRF , IL-23 alpha & IL-12 beta
Antigen Seq	IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS//RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Bioactivity	1. Measured by its binding ability in a functional ELISA.Immobilized Human IL-12B&IL-23A at 5μg/mL (100 μL/well) can bind Human IL23R with a linear range of 4-135 ng/ml.\|2. Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED₅₀ for this effect is 21. 23-84. 94 ng/mL, corresponding to a specific activity of 1. 17×10⁴~4. 71×10⁴ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	19.50 kDa(IL-12A), 34.71 kDa(IL-12B)
Gene Symbol	IL-12B&IL-23A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01160-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer