Vergleich

Recombinant Human Annexin A5/ANXA5 Protein Europäischer Partner

ArtNr RP01180-200ug
Hersteller Abclonal
Menge 200 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
NCBI Annexin A5/ANXA5
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ANX5,ENX2,HEL-S-7,PP4,RPRGL3,ANXA5,ENX2,HEL-S-7,PP4,RPRGL3
Similar products Annexin V, ANXA5, ANX5, ENX2, PP4, Annexin A5, Anchorin CII, Endonexin II, Lipocortin V, PAP-I, VAC-alpha, CBP-I
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
36.77 kDa
Description
Recombinant Human Annexin A5/ANXA5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp320) of human Annexin A5/Annexin V/ANXA5 (Accession #NP_001145.1) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Asp320
Route
C-His
Manufacturer - Research Area
Other Recombinant Protein
Revised name
Anchorin CII, ANXA5, ANX5, CBP-I, Endonexin II, Lipocortin V, ENX2, PP4, Annexin V, Annexin A5, PAP-I, PP4, VAC-alpha
Antigen Seq
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human Annexin A5 at 10 μg/mL (100 μL/well) can bind Human GSTO1 with a linear range of 0. 15-3. 16 μg/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
36.77 kDa
Gene Symbol
Annexin A5/ANXA5

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen