« Back
Home /
Recombinant Human Annexin A5/ANXA5 Protein

Recombinant Human Annexin A5/ANXA5 Protein

Item no.	RP01180-200ug
Manufacturer	Abclonal
Amount	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	Annexin A5/ANXA5
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ANX5,ENX2,HEL-S-7,PP4,RPRGL3,ANXA5,ENX2,HEL-S-7,PP4,RPRGL3
Similar products	Annexin V, ANXA5, ANX5, ENX2, PP4, Annexin A5, Anchorin CII, Endonexin II, Lipocortin V, PAP-I, VAC-alpha, CBP-I
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	36.77 kDa
Description	Recombinant Human Annexin A5/ANXA5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp320) of human Annexin A5/Annexin V/ANXA5 (Accession #NP_001145.1) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Asp320
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Revised name	Anchorin CII, ANXA5, ANX5, CBP-I, Endonexin II, Lipocortin V, ENX2, PP4, Annexin V, Annexin A5, PAP-I, PP4, VAC-alpha
Antigen Seq	MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human Annexin A5 at 10 μg/mL (100 μL/well) can bind Human GSTO1 with a linear range of 0. 15-3. 16 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	36.77 kDa
Gene Symbol	Annexin A5/ANXA5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01180-200ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer