« Zurück
Startseite /
Recombinant human CD24 Protein

Recombinant human CD24 Protein

ArtNr	RP01229-200ug
Hersteller	Abclonal
Menge	200 ug
Quantity options	1000 ug 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion By Organ Breast Cancer Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	CD24
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD24,CD24A,CD24 molecule,CD247
Similar products	CD24, CD24A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	31.85 kDa
Description	Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Gly59
Route	C-hFc
Manufacturer - Research Area	Immune Checkpoint, Bio-Markers & CD Antigens
Revised name	CD24, CD24A
Antigen Seq	MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Bioactivity	Measured by its binding ability in a functional ELISA.Immobilized Human CD24 at 2 μg/mL (100 μL/well) can bind Human Siglec10 with a linear range of 1-764 ng/mL.\|2. Measured by its binding ability in a functional ELISA.Immobilized PE Mouse Anti-Human CD24 at 1μg/mL (25 μL/well) can bind Human CD24 with a linear range of 0. 46-28. 4ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	31.85 kDa
Gene Symbol	CD24

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01229-200ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern