Vergleich

Recombinant human CD24 Protein Europäischer Partner

ArtNr RP01229-500ug
Hersteller Abclonal
Menge 500 ug
Quantity options 1000 ug 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
NCBI CD24
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD24,CD24A,CD24 molecule,CD247
Similar products CD24, CD24A
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
31.85 kDa
Description
Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Gly59
Route
C-hFc
Manufacturer - Research Area
Immune Checkpoint, Bio-Markers & CD Antigens
Revised name
CD24, CD24A
Antigen Seq
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Human CD24 at 2 μg/mL (100 μL/well) can bind Human Siglec10 with a linear range of 1-764 ng/mL.|2. Measured by its binding ability in a functional ELISA.Immobilized PE Mouse Anti-Human CD24 at 1μg/mL (25 μL/well) can bind Human CD24 with a linear range of 0. 46-28. 4ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
31.85 kDa
Gene Symbol
CD24

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen