« Zurück
Startseite /
Recombinant Human FGF-1/aFGF Protein

Recombinant Human FGF-1/aFGF Protein

ArtNr	RP01242-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Oncology Neuroscience Metabolism Regulation of Appetite Neural Signaling Neural Adhesion Molecules By Cell Type Carcinoma Glioma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Cell Status Senescence By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NCBI	FGF-1/aFGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AFGF,ECGF,ECGF-beta,ECGFA,ECGFB,FGF-1,FGF-alpha,FGFA,GLIO703,HBGF-1,HBGF1,FGF1,ECGF,ECGF-beta,ECGFA,ECGFB,FGF-1,FGF-alpha,FGFA,GLIO703,HBGF-1,HBGF1
Similar products	FGF1, aFGF, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1, FGF-1, HBGF-1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	16.67 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of human FGF acidic/FGF1 (Accession #NP_000791.1) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Phe16-Asp155
Route	C-His
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Growth Factor
Antigen Seq	FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human FGF1 at 5 μg/mL (100 μL/well) can bind Recombinant Human FGFR3 with a linear range of 0. 5-1. 5 μg/mL.\|2. Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED₅₀ for this effect is typically 22-140 pg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 50mM MOPS, 100mM Na2SO4, 10mM EDTA, pH7.9Contact us for customized product form or formulation.
Expected Protein Size	16.67 kDa
Gene Symbol	FGF-1/aFGF

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01242-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern