« Zurück
Startseite /
Recombinant Mouse LIF/Leukemia inhibitory factor Protein

Recombinant Mouse LIF/Leukemia inhibitory factor Protein

ArtNr	RP00544-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
NCBI	LIF/Leukemia inhibitory factor
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Leukemia inhibitory factor,Differentiation-stimulating factor,lif,D factor
Similar products	D factor, Leukemia inhibitory factor, Differentiation-stimulating factor, lif
Lieferbar
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Mouse Leukemia inhibitory factor is a secreted protein which belongs to the LIF/OSM family.LIF hasbeen implicated in a many physiological processes including development, hematopoiesis, bone metabolism, and inflammation. it has the capacity to induce terminal differentiation in leukemic cells. Its activities includethe induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronalcell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Immunogen	Ser24-Phe203
Route	No tag
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine receptors
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00544-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern