Comparison

Recombinant Mouse LIF/Leukemia inhibitory factor Protein European Partner

Item no. RP00544-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
NCBI LIF/Leukemia inhibitory factor
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Leukemia inhibitory factor,Differentiation-stimulating factor,lif,D factor
Similar products D factor, Leukemia inhibitory factor, Differentiation-stimulating factor, lif
Available
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Mouse Leukemia inhibitory factor is a secreted protein which belongs to the LIF/OSM family.LIF hasbeen implicated in a many physiological processes including development, hematopoiesis, bone metabolism, and inflammation. it has the capacity to induce terminal differentiation in leukemic cells. Its activities includethe induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronalcell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Immunogen
Ser24-Phe203
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close