Vergleich

Recombinant Mouse Beta-nerve growth factor/NGFB Protein Europäischer Partner

ArtNr RP00667-50ug
Hersteller Abclonal
Menge 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
NCBI Beta-NGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Beta-Nerve Growth Factor,Beta-NGF,NGF,NGFB
Similar products NGF, NGFB, Beta-NGF, Beta-Nerve Growth Factor
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
12.4 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse Beta-nerve growth factor/NGFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser122-Gly241) of Mouse Beta-nerve growth factor/NGFB (Accession #P01139) fused with no tag.
Background
NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophicfactor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knotfamily of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGFand 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection andrepair. β-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is apotent neurotrophic factor that signals through its receptor β -NGFR, and plays a crucial role in thedevelopment and preservation of the sensory and sympathetic nervous systems.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ser122-Gly241
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor, Cell Culture related
Antigen Seq
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH8.0.Contact us for customized product form or formulation.
Expected Protein Size
12.4 kDa
Gene Symbol
Beta-NGF

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen