Recombinant Mouse Beta-nerve growth factor/NGFB Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophicfactor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knotfamily of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGFand 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection andrepair. β-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is apotent neurotrophic factor that signals through its receptor β -NGFR, and plays a crucial role in thedevelopment and preservation of the sensory and sympathetic nervous systems.

Ser122-Gly241

< 1 EU/μg of the protein by LAL method.

SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

12.4 kDa