Vergleich

Recombinant Mouse P-Selectin/SELP/CD62P Protein Europäischer Partner

ArtNr RP01054-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 90% by SDS-PAGE.
Sequence WTYNYSTKAYSWNNSRVFCRRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNEPNNKKNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCSNQGECIETIGSYTCSCYPGFYGPECEYVKECGKVNIPQHVLMNCSHPLGEFSFNSQCTFSCAEGYELDGPGELQCLASGIWTNNPPKCDAVQCQSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGY
NCBI SELP/P-Selectin/CD62P
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias P-Selectin,CD62P,SELP,GMP-140,SELP/P-selectin,P-Selectin,CD62P,SELP,GMP-140,SELP/P-selectin
Similar products CD62P, SELP, P-Selectin, GMP-140
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
73.40 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse P-Selectin/SELP/CD62P Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp42-Ala709) of mouse P-Selectin/CD62P (Accession #NP_035477.1.) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Trp42-Ala709
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Bio-Markers & CD Antigens
Antigen Seq
WTYNYSTKAYSWNNSRVFCRRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNEPNNKKNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCSNQGECIETIGSYTCSCYPGFYGPECEYVKECGKVNIPQHVLMNCSHPLGEFSFNSQCTFSCAEGYELDGPGELQCLASGIWTNNPPKCDAVQCQSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGYRARGSNTLHCTGSGQWSEPLPTCEAIACEPPEIPIHGSMDCVPSTGTFGYNSSCTFLCAEGFVLKGNDAIQCADSGQWTAPAPFCEALQCPEFPVPSKAQVNCSDPFGTLTYQSVCSFSCDEGSLLVGASVIRCLATGHWNGAPPECQAVSCAPMLSPENGSMTCVQPLGNSTYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGTPPTCEAIKCPGIFAPEQGNLDCSHVHGEFGVGSICHFSCNEDFELLGSENVECTVSGRWSAPPPTCKGITSLPAPAVRCPALTTPGQGTMSCQHHLGSFGPNTTCYFGCKTGFTLRGANSLRCRASGQWTAVTPMCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCTFQCPEGQSLNGSVRATCREDGHWSDAMPTCQAGTLTIQEA
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 cells. When 5 x 10E4 cells/well are added to SELP-coated plates (10 μg/mL and 100 μL/well), approximately >40% cells will adhere specifically after 1 hour at 37°C.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
73.40 kDa
Gene Symbol
SELP/P-Selectin/CD62P

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen