« Zurück
Startseite /
Recombinant Mouse P-Selectin/SELP/CD62P Protein

Recombinant Mouse P-Selectin/SELP/CD62P Protein

ArtNr	RP01054-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Neuroscience Neural Signaling Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 90% by SDS-PAGE.
Sequence	WTYNYSTKAYSWNNSRVFCRRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNEPNNKKNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCSNQGECIETIGSYTCSCYPGFYGPECEYVKECGKVNIPQHVLMNCSHPLGEFSFNSQCTFSCAEGYELDGPGELQCLASGIWTNNPPKCDAVQCQSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGY
NCBI	SELP/P-Selectin/CD62P
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	P-Selectin,CD62P,SELP,GMP-140,SELP/P-selectin,P-Selectin,CD62P,SELP,GMP-140,SELP/P-selectin
Similar products	CD62P, SELP, P-Selectin, GMP-140
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	73.40 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Mouse P-Selectin/SELP/CD62P Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp42-Ala709) of mouse P-Selectin/CD62P (Accession #NP_035477.1.) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Trp42-Ala709
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Bio-Markers & CD Antigens
Antigen Seq	WTYNYSTKAYSWNNSRVFCRRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNEPNNKKNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCYTASCQDMSCSNQGECIETIGSYTCSCYPGFYGPECEYVKECGKVNIPQHVLMNCSHPLGEFSFNSQCTFSCAEGYELDGPGELQCLASGIWTNNPPKCDAVQCQSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGYRARGSNTLHCTGSGQWSEPLPTCEAIACEPPEIPIHGSMDCVPSTGTFGYNSSCTFLCAEGFVLKGNDAIQCADSGQWTAPAPFCEALQCPEFPVPSKAQVNCSDPFGTLTYQSVCSFSCDEGSLLVGASVIRCLATGHWNGAPPECQAVSCAPMLSPENGSMTCVQPLGNSTYKSTCQFMCDEGFYLSGPERLDCSPSGHWTGTPPTCEAIKCPGIFAPEQGNLDCSHVHGEFGVGSICHFSCNEDFELLGSENVECTVSGRWSAPPPTCKGITSLPAPAVRCPALTTPGQGTMSCQHHLGSFGPNTTCYFGCKTGFTLRGANSLRCRASGQWTAVTPMCRAVKCSELHMDTAVAMNCSNPWGNFSYGSTCTFQCPEGQSLNGSVRATCREDGHWSDAMPTCQAGTLTIQEA
Bioactivity	Measured by the ability of the immobilized protein to support the adhesion of U937 cells. When 5 x 10E4 cells/well are added to SELP-coated plates (10 μg/mL and 100 μL/well), approximately >40% cells will adhere specifically after 1 hour at 37°C.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	73.40 kDa
Gene Symbol	SELP/P-Selectin/CD62P

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01054-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern