Vergleich

Recombinant Mouse IL-4 Protein Europäischer Partner

ArtNr RP01161-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
NCBI IL-4
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Il-4,BSF-1,IL4
Similar products BSF-1, Lymphocyte stimulatory factor 1, B-cell IgG differentiation factor, B-cell growth factor 1, IGG1 induction factor, Il-4
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
14.15 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse IL-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His23-Ser140) of mouse IL-4 (Accession #NP_067258.1) fused with a 6×His tag at the C-terminus.
Background
Interleukin-4, also known as IL4, is a secreted protein that belongs to the IL-4 / IL-13 family. Interleukin-4 / IL4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation. It enhances both secretion and cell surface expression of IgE and IgG1. Interleukin-4 / IL4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Interleukin-4 is essential for the switching of B cells to IgE antibody production and the maturation of T helper (Th) cells toward the Th2 phenotype.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His23-Ser140
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin, Cell Culture related
Antigen Seq
HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Bioactivity
1. Measured in a cell proliferation assay using MC/9 2 mouse mast cells. The ED50 for this effect is 2. 8-11. 3 pg/mL, corresponding to a specific activity of 8. 85×107~3. 57×108 units/mg.|2. Measured in a cell proliferation assay using HT-2 mouse T cells. The ED50 for this effect is 0. 21-0. 85 ng/mL, corresponding to a specific activity of 1. 18×106~4. 76×106 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
14.15 kDa
Gene Symbol
IL-4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen