Active Recombinant Human BMP-7

Recombinant human BMP 7 is a protein composed of 16.5 kDa single chain, containing 144 amino residues.

8.49

P18075

Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAA YYCEGECAFPLNSYMNATNHAIVQTLVHFINPETV PKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVR ACGCH

Purity >97% by SDS-PAGE gel

The biological activity of BMP-7 is measured by its ability to induce alkaline phosphatase production by ATDC5 cells. - ED50 <= 40ng/ml

-

- Chen D, Zhao M, Mundy GR: Bone morphogenetic proteins. Growth Factors 22:233–241, 2004. - Kishigami S. and Mishina Y. 2005. BMP signalling and early embryonic patterning. Cytokine Growth Factor Rev. 16: 265–278. - T K Sampath, J C Maliakal, P V Hauschka, W K Jones, H Sasak, R F Tucker, K H White, J E Coughlin, M M Tucker and R H Pang (1992). Recombinant human osteogenic protein-1 (hOP-1) induces new bone formation in vivo with a specific activity comparable with natural bovine osteogenic protein and stimulates osteoblast proliferation and differentiation in vitro. J. Biol. Chem. 267:20352. - Kazama I, Mahoney ZX, Miner JH, Graf D, Economides AN, KreidbergJA. Podocyte-specific deletion of BMP7 leads to growth defect of nephrons with inactivation of P38MAPK. J Am Soc Nephrol 19: 2181–2191, 2008. - Grishina IB, Kim SY, Ferrara C, Makarenkova HP, Walden PD. BMP7 inhibits branching morphogenesis in the prostate gland and interferes with Notch signalling. Dev Biol. 2005, 288:334–347 - Zeisberg M, Hanai J, Sugimoto H, Mammoto T, Charytan D, Strutz F, Kalluri R. BMP-7 counteracts TGF-beta1-induced epithelial-to-mesenchymal transition and reverses chronic renal injury. Nat. Med. 9:964-968, 2003 - Buijs JT, Rentsch CA, van der Horst G, van Overveld PG, Wetterwald A, Schwaninger R, Henriquez NV, Dijke P, Borovecki F and Markwalder R. BMP7, a putative regulator of epithelial homeostasis in the human prostate, is a potent inhibitor of prostate cancer bone metastasis in vivo . Am J Pathol . 2007, 171:1047–1057 - Yu MA, Shin KS, Kim JH, Kim YI, Chung SS, Park SH, Kim YL, Kang DH: HGF and BMP-7 ameliorate high glucose-induced epithelial-to-mesenchymal transition of peritoneal mesothelium. J Am Soc Nephrol 20: 567–581, 2009 - Chou J, Harvey BK, Chang CF, Shen H, Morales M, Wang Y (2006) Neuroregenerative effects of BMP7 after stroke in rats. J Neurol Sci 240:21–29.

This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.

1 ug, 5 ug, 10 ug, 20 ug, 100 ug of active protein