« Back
Home /
Active Recombinant Human BMP-7

Active Recombinant Human BMP-7

Item no.	RF0027-5
Manufacturer	Agrenvec
Amount	5ug
Category	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Osteogenic protein 1
Available
Molecular Weight:	Recombinant human BMP 7 is a protein composed of 16.5 kDa single chain, containing 144 amino residues.
Molecular Formula:	C719H1103N215O214S10
p.I:	8.49
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =	1321
UniProtKB:	P18075
Endotoxin level:	Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:	Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:	The bone morphogenetic proteins are a family of secreted signalling molecules that can induce ectopic bone growth. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extra skeletal site. Bone morphogenetic protein 7 (BMP7), also known as osteogenic protein 1 (OP1), is a widely expressed TGFb superfamily member with important functions during embryogenesis, in the adult, and in disease (Chen et al., 2004, Kishigami and Mishina 2005). BMP7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development (Sampath et al., 1992, Kazama et al., 2008), inhibits the branching of prostate epithelium (Grishina et al., 2005), and antagonizes epithelial-mesenchymal transition (EMT) (Zeisberg et al., 2003, Yu et al., 2009).In pathological conditions, BMP7 inhibits tumour growth and metastasis (Buijs et al., 2007), ameliorates fibrotic damage in nephritis (Zeisberg et al., 2003), and promotes neuroregeneration following brain ischemia (Chou et al., 2006).
Sequence:	HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAA YYCEGECAFPLNSYMNATNHAIVQTLVHFINPETV PKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVR ACGCH
Formulation:	Recombinant human BMP 7 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4.
Purity	Purity >97% by SDS-PAGE gel
Applications:	Functional studies, Cell culture, Western Blot.
Bioassay 1 - Result assay 1:	The biological activity of BMP-7 is measured by its ability to induce alkaline phosphatase production by ATDC5 cells. - ED50 <= 40ng/ml
Bioassay 2 - Result assay 2:	-
Bioassay 3 - Result assay 3:	-
Bioassay 4 - Result assay 4:	-
References:	- Chen D, Zhao M, Mundy GR: Bone morphogenetic proteins. Growth Factors 22:233–241, 2004. - Kishigami S. and Mishina Y. 2005. BMP signalling and early embryonic patterning. Cytokine Growth Factor Rev. 16: 265–278. - T K Sampath, J C Maliakal, P V Hauschka, W K Jones, H Sasak, R F Tucker, K H White, J E Coughlin, M M Tucker and R H Pang (1992). Recombinant human osteogenic protein-1 (hOP-1) induces new bone formation in vivo with a specific activity comparable with natural bovine osteogenic protein and stimulates osteoblast proliferation and differentiation in vitro. J. Biol. Chem. 267:20352. - Kazama I, Mahoney ZX, Miner JH, Graf D, Economides AN, KreidbergJA. Podocyte-specific deletion of BMP7 leads to growth defect of nephrons with inactivation of P38MAPK. J Am Soc Nephrol 19: 2181–2191, 2008. - Grishina IB, Kim SY, Ferrara C, Makarenkova HP, Walden PD. BMP7 inhibits branching morphogenesis in the prostate gland and interferes with Notch signalling. Dev Biol. 2005, 288:334–347 - Zeisberg M, Hanai J, Sugimoto H, Mammoto T, Charytan D, Strutz F, Kalluri R. BMP-7 counteracts TGF-beta1-induced epithelial-to-mesenchymal transition and reverses chronic renal injury. Nat. Med. 9:964-968, 2003 - Buijs JT, Rentsch CA, van der Horst G, van Overveld PG, Wetterwald A, Schwaninger R, Henriquez NV, Dijke P, Borovecki F and Markwalder R. BMP7, a putative regulator of epithelial homeostasis in the human prostate, is a potent inhibitor of prostate cancer bone metastasis in vivo . Am J Pathol . 2007, 171:1047–1057 - Yu MA, Shin KS, Kim JH, Kim YI, Chung SS, Park SH, Kim YL, Kang DH: HGF and BMP-7 ameliorate high glucose-induced epithelial-to-mesenchymal transition of peritoneal mesothelium. J Am Soc Nephrol 20: 567–581, 2009 - Chou J, Harvey BK, Chang CF, Shen H, Morales M, Wang Y (2006) Neuroregenerative effects of BMP7 after stroke in rats. J Neurol Sci 240:21–29.
RESCONSTITUTION RECOMENDATION QC SHEET	Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:	This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping	Room temperature
Available sizes (ug) :	1 ug, 5 ug, 10 ug, 20 ug, 100 ug of active protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer