« Zurück
Startseite /
omega-Agatoxin IVA Biotin

omega-Agatoxin IVA Biotin

ArtNr	ALO-STA-500-B-10ug
Hersteller	Alomone
Menge	10 ug
Quantity options	10 ug 2 x 10 ug 2 x 50 ug 50 ug
Kategorie	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience
Format	Lyophilized
Specific against	other
Konjugat/Tag	Biotin
Sequence	KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Non Antibodies
Manufacturer - Category	Proteins
Manufacturer - Targets	P-type Ca2+ channels (CACNA1A)
Manufacturer - Conjugate / Tag	LC-Biotin. The extent of labeling is 1-2 molecules of biotin per ω-Agatoxin IVA molecule.
Country of Origin	Israel
Shipping Temperature	The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions	Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day.
Molecular Weight	5710 Da
Manufacturer - Format	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Description	Biotinylated Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels and Presynaptic Neuromuscular Junctions.
PH	7, 4
UNSPSC	12352202
Origin	Agelenopsis aperta (North American funnel-web spider).
Modifications	LC-Biotin (conjugated via amine group)Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34
Effective Concentration	0.5 – 5 µM
Activity	ω-Agatoxin IVA is a blocker of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2, 3.
Bioassay tested	Yes

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

ALO-STA-500-B-10ug-safety-datasheet.pdf