« Back
Home /
omega-Agatoxin IVA Biotin

omega-Agatoxin IVA Biotin

Item no.	ALO-STA-500-B-10ug
Manufacturer	Alomone
Amount	10 ug
Quantity options	10 ug 2 x 10 ug 2 x 50 ug 50 ug
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience
Format	Lyophilized
Specific against	other
Conjugate/Tag	Biotin
Sequence	KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
Shipping Condition	Room temperature
Available
Manufacturer - Type	Non Antibodies
Manufacturer - Category	Proteins
Manufacturer - Targets	P-type Ca2+ channels (CACNA1A)
Manufacturer - Conjugate / Tag	LC-Biotin. The extent of labeling is 1-2 molecules of biotin per ω-Agatoxin IVA molecule.
Country of Origin	Israel
Shipping Temperature	The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions	Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day.
Molecular Weight	5710 Da
Manufacturer - Format	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Description	Biotinylated Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels and Presynaptic Neuromuscular Junctions.
PH	7, 4
UNSPSC	12352202
Origin	Agelenopsis aperta (North American funnel-web spider).
Modifications	LC-Biotin (conjugated via amine group)Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34
Effective Concentration	0.5 – 5 µM
Activity	ω-Agatoxin IVA is a blocker of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2, 3.
Bioassay tested	Yes

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

ALO-STA-500-B-10ug-safety-datasheet.pdf