« Zurück
Startseite /
Beta-Amyloid (1-40), FAM-labeled

Beta-Amyloid (1-40), FAM-labeled

ArtNr	AS-23514-01
Hersteller	AnaSpec
CAS-Nr.	1678416-08-4
Menge	0.1 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Citations	Ref: Prior, R. et al. Am. J. Pathol. 148, 1749 (1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (1-40)
Manufacturer - Conjugate / Tag	Fluorescent dyes: FAM
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	4688.5
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability. - 494/521
Absorbtion (nm)	494
Emission (nm)	521
Sequence One-Letter Code	FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Detection Method	Fluorescent
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535042707

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-23514-01-safety-datasheet.pdf