« Back
Home /
Beta-Amyloid (1-40), FAM-labeled

Beta-Amyloid (1-40), FAM-labeled

Item no.	AS-23514-01
Manufacturer	AnaSpec
CASRN	1678416-08-4
Amount	0.1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Citations	Ref: Prior, R. et al. Am. J. Pathol. 148, 1749 (1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (1-40)
Manufacturer - Conjugate / Tag	Fluorescent dyes: FAM
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	4688.5
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability. - 494/521
Absorbtion (nm)	494
Emission (nm)	521
Sequence One-Letter Code	FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Detection Method	Fluorescent
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535042707

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-23514-01-safety-datasheet.pdf