Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant

Lyophilized powder at room temperature.

FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques.
Amino Acid Sequence:SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY.
Source: Insect Cells.
Physical Appearance and Stability: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution FLT1 should be stored at 4° C between 2-7 days and for future use below -18° C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. Greater than 90.0% as determined by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.