Vergleich

Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant

Hersteller Angio-Proteomie
Kategorie
Typ Proteins Recombinant
Specific against other
Menge 2ug
ArtNr ANG-rAP-2111-2ug
Targets VEGFA
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Description
Product Name: Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant
Synonyms: FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1.
Description: FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques.
Uniprot Accesion Number: P17948
Amino Acid Sequence:SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY.
Source: Insect Cells.
Physical Appearance and Stability: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution FLT1 should be stored at 4° C between 2-7 days and for future use below -18° C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. Greater than 90.0% as determined by SDS-PAGE.
Application:
Solubility: It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 2ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen