Description |
Product Name: Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Synonyms: FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1. Description: FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques. Uniprot Accesion Number: P17948 Amino Acid Sequence:SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY. Source: Insect Cells. Physical Appearance and Stability: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution FLT1 should be stored at 4° C between 2-7 days and for future use below -18° C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. Formulation and Purity: FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. Greater than 90.0% as determined by SDS-PAGE. Application: Solubility: It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells. Shipping Format and Condition: Lyophilized powder at room temperature. Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |