Vergleich

SARS MERS Spike S1 Recombinant

ArtNr ANG-rAP-5466-500ug
Hersteller Angio-Proteomie
Menge 500 ug
Quantity options 1000 ug 100 ug 1 ea 500 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Applikationen IA
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Applications
Immunoassay
Shipping Temperature
Lyophilized powder at room temperature
Usage statement
Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Description: Recombinant SARS MERS Spike S1 is a peptide from amino acids 56-295 of spike protein S1 produced in E. coli and fused to a 6xHis tag at its C-terminus (UniProt accession #AHC74088).SARS MERS is purified by a proprietary chromatographic technique.
Amino Acid Sequence:EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH.
Physical Appearance and Stability: Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation and Purity: SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. Protein is > 95% pure as determined by 12% PAGE (coomassie staining).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen