Comparison

SARS MERS Spike S1 Recombinant

Item no. ANG-rAP-5466-500ug
Manufacturer Angio-Proteomie
Amount 500 ug
Quantity options 1000 ug 100 ug 1 ea 500 ug
Category
Type Proteins Recombinant
Format Lyophilized
Applications IA
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Applications
Immunoassay
Shipping Temperature
Lyophilized powder at room temperature
Usage statement
Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Description: Recombinant SARS MERS Spike S1 is a peptide from amino acids 56-295 of spike protein S1 produced in E. coli and fused to a 6xHis tag at its C-terminus (UniProt accession #AHC74088).SARS MERS is purified by a proprietary chromatographic technique.
Amino Acid Sequence:EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH.
Physical Appearance and Stability: Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation and Purity: SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. Protein is > 95% pure as determined by 12% PAGE (coomassie staining).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close