Vergleich

Anti-Ataxin-1, 11NQ Antibody

ArtNr 75-122
Hersteller Antibodies Incorporated
Menge 100 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IP, IHC, ICC
Clon N76/3
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Drosophila
Host Mouse
Isotype IgG1
Konjugat/Tag Unconjugated
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Primary Antibody
Manufacturer - Targets
Ataxin-1, 11NQ
Country of Origin
United States
Shipping Temperature
Shipped on ice packs
Storage Conditions
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight
85 kDa
Manufacturer - Research Area
Rare Diseases
Expiration
24 months from date of receipt
Immunogen
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Immunogen Species
Mouse
Description
Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/3. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.
Target Description
Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.
Clonality
Monoclonal
Manufacturer - Specificity
No cross-reactivity reported
Concentration
1 mg/mL
Form
Purified by Protein A chromatography
Buffer
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.49
Production Notes
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application
ICC
Dilution Range: WB
1:1000
Dilution Range: IHC
1:1000
Dilution Range: IP
1:50
Usage Statement
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement
We produce our Ataxin-1, 11NQ mouse monoclonal primary antibody from hybridoma clone N76/3. It is great in IHC, ICC, IP, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 11.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen