« Back
Home /
Anti-Ataxin-1, 11NQ Antibody

Anti-Ataxin-1, 11NQ Antibody

Item no.	75-122
Manufacturer	Antibodies Incorporated
Amount	100 uL
Category	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Antibodies By Cell Type Carcinoma Glioma Cell Biology Cell Status Apoptosis Immunohistochemistry Immunoprecipitation Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IP, IHC, ICC
Clone	N76/3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Drosophila
Host	Mouse
Isotype	IgG1
Conjugate/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
Shipping Condition	Cool pack
Available
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	Ataxin-1, 11NQ
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	85 kDa
Manufacturer - Research Area	Rare Diseases
Expiration	24 months from date of receipt
Immunogen	Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Immunogen Species	Mouse
Description	Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/3. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.
Target Description	Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.
Clonality	Monoclonal
Manufacturer - Specificity	No cross-reactivity reported
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.49
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application	ICC
Dilution Range: WB	1:1000
Dilution Range: IHC	1:1000
Dilution Range: IP	1:50
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our Ataxin-1, 11NQ mouse monoclonal primary antibody from hybridoma clone N76/3. It is great in IHC, ICC, IP, WB and is purified by Protein A chromatography.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 8/28/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer