Vergleich

CD31/PECAM1 Rabbit mAb Europäischer Partner

ArtNr A23691-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, FC, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI Pecam1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Cd31,Pecam,PECAM-1,CD31/PECAM1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
81kDa
Background
Predicted to enable protein homodimerization activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction; endothelial cell morphogenesis; and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone; external side of plasma membrane; and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; extraembryonic component; and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).
Manufacturer - Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 18-220 of mouse CD31/PECAM1(NP_001292086.1).
Recommended Dilution
WB, 1:500 - 1:1000|FC, 1:50 - 1:200
Protein Size
81kDa
Route
Recombinant protein
Manufacturer - Research Area
Cancer, Tumor immunology, Invasion and Metastasis, Signal Transduction, Cell Biology & Developmental Biology, Cell Adhesion, Cell Adhesion Molecules, Cytoskeleton, Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis, Blood.
Antigen Seq
ENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLM
Manufacturer - Gene ID (Human)
5175
Expected Protein Size
81kDa
Gene Symbol
Pecam1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 18.12.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen