Comparison

CD31/PECAM1 Rabbit mAb European Partner

Item no. A23691-1000uL
Manufacturer Abclonal
Amount 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Category
Type Antibody Monoclonal
Applications WB, FC, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
NCBI Pecam1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Cd31,Pecam,PECAM-1,CD31/PECAM1
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
81kDa
Background
Predicted to enable protein homodimerization activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction; endothelial cell morphogenesis; and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone; external side of plasma membrane; and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; extraembryonic component; and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).
Manufacturer - Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 18-220 of mouse CD31/PECAM1(NP_001292086.1).
Recommended Dilution
WB, 1:500 - 1:1000|FC, 1:50 - 1:200
Protein Size
81kDa
Route
Recombinant protein
Manufacturer - Research Area
Cancer, Tumor immunology, Invasion and Metastasis, Signal Transduction, Cell Biology & Developmental Biology, Cell Adhesion, Cell Adhesion Molecules, Cytoskeleton, Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis, Blood.
Antigen Seq
ENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLM
Manufacturer - Gene ID (Human)
5175
Expected Protein Size
81kDa
Gene Symbol
Pecam1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Delivery expected until 12/18/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close