Vergleich

UTX(Kdm6a) Rabbit pAb Europäischer Partner

ArtNr A24048-100uL
Hersteller Abclonal
Menge 100 uL
Quantity options 100 uL 200 uL 20 ul 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence DSSLPTNSVSGQQPQLPLTRMPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNTLTVPETSRQTGETPNSTASVEGLPNHVHQVMADAVCSPSHGDSKSPGLLSSDNPQL
NCBI Kdm6a
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Kdm6a,UTX(Kdm6a)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
The methylation status of histone lysine residues is a major determinant of the formation of both activated and inactive regions of the genome, and plays a crucial role in the correct programming of the genome during development. Proteins containing the Jumonji C (JmjC) domain represent the largest category of potential histone demethylase proteins. The JmjC domain can be achieved through iron ions and α- The oxidation reaction of ketoglutaric acid catalyzes the demethylation of single, double, and trimethyllysine residues. Based on homology, both humans and mice contain at least 30 such proteins, which can be divided into 7 different families. The three members of the UTX/UTY family include the widely transcribed X chromosome 34 peptide repeat protein (UTX), the widely transcribed Y chromosome 34 peptide repeat protein (UTY), and the protein 3 containing the JmjC domain (JMJD3). This protein family can demethylate the histones H3 Lys 27 of both dimethyl and trimethyl histones. In women, the UTX gene can escape X chromosome inactivation and is widely expressed. During development, UTX can regulate HOX gene expression. JMJD3 regulates gene expression in macrophages under different inflammatory stimuli and is upregulated in prostate cancer. UTX and JMJD3 both interact with mixed lineage leukemia (MLL) complexes 2 and 3, which can methylate histone H3 at the Lys4 site. The UTY gene is expressed in most tissues of male mice.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 530-780 of mouse UTX.
Recommended Dilution
WB, 1:500 - 1:1000
Route
Recombinant protein
Manufacturer - Research Area
Chromatin regulator, dioxygenase, oxidoreductase

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen