Vergleich

ABflo® 594 Rabbit anti-Mouse IgE mAb Europäischer Partner

ArtNr A24276-200T
Hersteller Abclonal
Menge 200 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Kategorie
Typ Antibody Monoclonal
Applikationen FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag ABflo® 594. Ex:594nm. Em:619nm.
Purity Affinity purification
Sequence FNESRTILVRPVNITEPTLELLHSSCDPNAFHSTIQLYCFIYGHILNDVSVSWLMDDREITDTLAQTVLIKEEGKLASTCSKLNITEQQWMSESTFTCKVTSQGVDYLAHTRRCPDHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFP
NCBI immunoglobulin epsilon heavy chain constant
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias IGHE,Ig epsilon chain C region
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Background
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens 1, 2. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen
Immunogen
Recombinant fusion protein containing a sequence corresponding to aminoacids 83-421 of mouse IgE(P06336).
Recommended Dilution
FC(Intra), 5 μl per 10^6 cells in 100 μl volume
Protein Size
47kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology Immunoglobulins Heavy Chain IgE

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 T
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen