Comparison

ABflo® 594 Rabbit anti-Mouse IgE mAb European Partner

Item no. A24276-200T
Manufacturer Abclonal
Amount 200 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Conjugate/Tag ABflo® 594. Ex:594nm. Em:619nm.
Purity Affinity purification
Sequence FNESRTILVRPVNITEPTLELLHSSCDPNAFHSTIQLYCFIYGHILNDVSVSWLMDDREITDTLAQTVLIKEEGKLASTCSKLNITEQQWMSESTFTCKVTSQGVDYLAHTRRCPDHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFP
NCBI immunoglobulin epsilon heavy chain constant
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias IGHE,Ig epsilon chain C region
Shipping Condition Cool pack
Available
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Background
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens 1, 2. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen
Immunogen
Recombinant fusion protein containing a sequence corresponding to aminoacids 83-421 of mouse IgE(P06336).
Recommended Dilution
FC(Intra), 5 μl per 10^6 cells in 100 μl volume
Protein Size
47kDa
Route
Recombinant protein
Manufacturer - Research Area
Immunology Immunoglobulins Heavy Chain IgE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close