Vergleich

Bcl-2 Rabbit pAb Europäischer Partner

ArtNr A25052-200uL
Hersteller Abclonal
Menge 200 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IP, ELISA
Specific against Rat (Rattus norvegicus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI Bcl-2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Bcl-2,
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
26kDa
Background
Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).
Manufacturer - Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of rat Bcl2(NP_058689.2).
Recommended Dilution
WB, 1:500 - 1:1000|IP, 1:50 - 1:200
Protein Size
26kDa
Route
Recombinant protein
Manufacturer - Research Area
Apoptosis regulation, Autophagy signal transduction, Ddeath receptor signal transduction.
Antigen Seq
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Manufacturer - Gene ID (Human)
596
Expected Protein Size
26kDa
Gene Symbol
Bcl-2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 27.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen