« Zurück
Startseite /
Anti-SOX10 Picoband Antibody

Anti-SOX10 Picoband Antibody

ArtNr	ABC-ABO10108
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	SOX10, Transcription factor SOX-10
Lieferbar
Primary Accession	P56693
Application	WB
Clonality	Polyclonal
Gene ID	6663
Reactivity	H, M, Rat
Calculated MW	49911
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for SOX10 detection. Tested with WB in Human; Mouse; Rat.
Protein Function	Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia (By similarity). .
Subcellular Localization	Cytoplasm. Nucleus.
Tissue Specificity	Expressed in fetal brain and in adult brain, heart, small intestine and colon.
Contents	Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg NaN₃.
Immunogen	A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL).
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C; for one year. After r?Constitution, at 4?C; for one month. It?Can also be aliquotted and stored frozen at -20?C; for a longer time. Avoid repeated freezing and thawing.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO10108-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 27 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern