Vergleich

Anti-ROC1 Picoband Antibody

ArtNr ABC-ABO12484
Hersteller Abcepta
Menge 100 ug
Kategorie
Typ Antibody Primary
Format Lyophilized
Applikationen WB
Specific against other
Host Rabbit
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Similar products RBX1, N-terminally processed, ROC1, RNF75, Rbx1, E3 ubiquitin-protein ligase RBX1, Protein ZYP, RING finger protein 75, RING-box protein 1, Regulator of cullins 1, 6.3.2.-
Lieferbar
Primary Accession
P62877
Application
WB
Clonality
Polyclonal
Gene ID
9978
Reactivity
H, M, Rat
Legend image 1
Anti- ROC1 Picoband antibody, ABO12484, Western blottingAll lanes: Anti ROC1 (ABO12484) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Mouse Brain Tissue Lysate at 50ugLane 4: Mouse Spleen Tissue Lysate at 50ugPredicted bind size: 15KDObserved bind size: 15KD
Type image 1
WB
Dilution image 1
0.1-0.5 µg/ml
Calculated MW
12274
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description
Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase RBX1(RBX1) detection. Tested with WB in Human; Mouse; Rat.
Protein Function
E3 ubiquitin ligase component of multiple cullin-RING- based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, like CDC34, to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM. .
Subcellular Localization
Cytoplasm . Nucleus .
Tissue Specificity
Widely expressed.
Protein Name
E3 ubiquitin-protein ligase RBX1
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ROC1 (76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH), identical to the related mouse sequence.
Purification
Immunogen affinity purified.
Cross Reactivity
No cross reactivity with other proteins.
Storage
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen