TLR4 antibody - N-terminal region (OASA06094)

ArtNr	OASA06094
Hersteller	AVIVA Systems Biology
Menge	0.1mg
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Antibodies Obesity Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Purified IgG - liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens)
Host	Goat
Isotype	IgG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TOLL, CD284, hToll, ARMD10, TLR4
Similar products	TLR4
Lieferbar
Description	GOAT ANTI HUMAN CD284 (N-TERMINAL)
Short description	GOAT ANTI HUMAN CD284 (N-TERMINAL)
Gene symbol	TLR4
Alias symbols	TOLL, CD284, hToll, ARMD10, TLR4
Protein size	839
Gene_id	7099
Reconstitution and storage	Store at +4C or at -20C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Description of target	GOAT ANTI HUMAN CD284 (N-TERMINAL)
Specificity	CD284
Homology short	Human
Immunogen	The immunogen for anti-TLR4 antibody: synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
Application Info	Immunohistology - Paraffin(1): 1/100 - 1/300 Western Blotting: 1/1000 (1)Special conditions apply.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OASA06094-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.1mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern