EGR1 Antibody

ArtNr	OAAL00088
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, ELISA
Clon	1F5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR*
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AT225;early growth response protein 1;EGR-1;G0S30;KROX-24;nerve growth factor-induced protein A;NGFI-A;TIS8;transcription factor ETR103;transcription factor Zif268;ZIF-268;zinc finger gene 225;zinc finger protein 225;zinc finger protein Krox-24;ZNF225.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	EGR1
Gene Fullname	early growth response 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq
Nucleotide accession_num	NM_001964
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_001955
Protein name	early growth response protein 1 [Homo sapiens]\|Homo sapiens early growth response 1 (EGR1), mRNA
Clonality	Monoclonal
Immunogen	EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00088-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern