« Back
Home /
EGR1 Antibody

EGR1 Antibody

Item no.	OAAL00088
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	1F5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR*
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AT225;early growth response protein 1;EGR-1;G0S30;KROX-24;nerve growth factor-induced protein A;NGFI-A;TIS8;transcription factor ETR103;transcription factor Zif268;ZIF-268;zinc finger gene 225;zinc finger protein 225;zinc finger protein Krox-24;ZNF225.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	EGR1
Gene Fullname	early growth response 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq
Nucleotide accession_num	NM_001964
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_001955
Protein name	early growth response protein 1 [Homo sapiens]\|Homo sapiens early growth response 1 (EGR1), mRNA
Clonality	Monoclonal
Immunogen	EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00088-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer