« Zurück
Startseite /
Recombinant Human Filaggrin (FLG), partial

Recombinant Human Filaggrin (FLG), partial

ArtNr	BM-RPC20626-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	DSSRHSQSGQGESAGSRRSRRQGSSVSQDSDSEAY PEDSERRSESASRNHHGSSREQSRDGSRHPGSSHR DTASHVQSSPVQSDSSTAKEHGHFSSLSQDSAYHS GIQSRGSPHSSSSYHYQSEGTERQKGQSGLVWRHG SYGSADYDYGESGFRHSQHGSVSYNSNPVVFKERS DICKASAFGKDHPRYYATYINKDPGLCGHSSDISK QLGFSQSQRYYYYE
Protein Familie	S100-fused protein family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	Unconjugated, N-Terminal 10Xhis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	26.8 kDa
Expression Region	3838-4061aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
Subcellular location	Cytoplasmic granule
Involvement in disease	Ichthyosis vulgaris (VI); Dermatitis atopic 2 (ATOD2)
Function	Aggregates keratin intermediate filaments and promotes disulfide-bond formation among the intermediate filaments during terminal differentiation of mammalian epidermis.
Activity	Not Tested
Tissue Specificity	Expressed in skin, thymus, stomach, tonsils, testis, placenta, kidney, pancreas, mammary gland, bladder, thyroid, salivary gland and trachea, but not detected in heart, brain, liver, lung, bone marrow, small intestine, spleen, prostate, colon, or adrenal gland (PubMed:19384417). In the skin, mainly expressed in stratum granulosum of the epidermis (PubMed:1429717) (PubMed:19384417).
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	FLG
Sequence Information	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern