« Zurück
Startseite /
Recombinant Human Ezrin (EZR), partial

Recombinant Human Ezrin (EZR), partial

ArtNr	BM-RPC25886-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Oncology Neuroscience Neural Lineage Markers By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Adenocarcinoma Microglia Markers
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CytovillinVillin-2p81
Similar products	CytovillinVillin-2p81
Lieferbar
Gene Name	EZR
Alternative Names	CytovillinVillin-2p81
Uniprot	P15311
Source	Yeast
Expression Region	1-251aa
AA Sequence	MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVK TIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQ VKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVW HAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEI RNISFN
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	31.4 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Probably involved in connections of major cytoskeletal structures to the plasma mbrane. In epithelial cells, required for the formation of microvilli and mbrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
Function	Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
Subcellular location	Apical cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, Cell projection, microvillus membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cell cortex, Cytoplasm, cytoskeleton
Tissue Specificity	Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protein level). Component of the microvilli of intestinal epithelial cells. Preferentially expressed in astrocytes of hippocampus, frontal cortex, thalamus, parahippocampal cortex, amygdala, insula, and corpus callosum. Not detected in neurons in most tissues studied.
Paythway	Regulationofactincytoskeleton

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 04.09.2025