« Zurück
Startseite /
Recombinant Human Hemoglobin subunit gamma-2 (HBG2)

Recombinant Human Hemoglobin subunit gamma-2 (HBG2)

ArtNr	BM-RPC26052-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)
Similar products	Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)
Lieferbar
Gene Name	HBG2
Alternative Names	Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)
Uniprot	P69892
Source	E.coli
Expression Region	2-147aa
AA Sequence	GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVY PWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTS LGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKL LGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASA LSSRYH
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	23.0 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Function	Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Involvement in disease	Cyanosis transient neonatal (TNCY)
Protein Families	Globin family
Tissue Specificity	Red blood cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern