« Zurück
Startseite /
Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial

ArtNr	BM-RPC26372-1mg
Hersteller	Biomatik
Menge	1mg
Kategorie	Neuroscience Metabolism Diabetes Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Necrosis
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Attachment glycoprotein GMembrane-bound glycoprotein (mG)
Similar products	Attachment glycoprotein GMembrane-bound glycoprotein (mG)
Lieferbar
Gene Name	G
Alternative Names	Attachment glycoprotein GMembrane-bound glycoprotein (mG)
Uniprot	P03423
Source	Baculovirus
Expression Region	67-298aa
AA Sequence	HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISP SNPSEITSQITTILASTTPGVKSTLQSTTVKTKNT TTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFV PCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKP TLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKT NIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSP SQVSTTSEYPSQPSSPPNTPRQ
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	29.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Attaches the virion to the host cell mbrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hagglutinating activities.Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.
Function	Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.; FUNCTION
Subcellular location	Virion membrane, Host cell surface, SUBCELLULAR LOCATION: Isoform Secreted glycoprotein G: Secreted
Protein Families	Pneumoviruses glycoprotein G family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern