« Zurück
Startseite /
Recombinant Human Microsomal glutathione S-transferase 2 (MGST2)

Recombinant Human Microsomal glutathione S-transferase 2 (MGST2)

ArtNr	BM-RPC26476-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Microsomal GST-II (Microsomal GST-2) (GST2)
Similar products	Microsomal GST-II (Microsomal GST-2) (GST2)
Lieferbar
Gene Name	MGST2
Alternative Names	Microsomal GST-II (Microsomal GST-2) (GST2)
Uniprot	Q99735
Source	in vitro E.coli expression system
Expression Region	1-147aa
AA Sequence	MAGNSILLAAVSILSACQQSYFALQVGKARLKYKV TPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMA GWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRI TGFRLSLGILALLTLLGALGIANSFLDEYLDLNIA KKLRRQF
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	19.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Can catalyze the production of LTC4 from LTA4 and reduced glutathione. Can catalyze the conjugation of 1-chloro-2, 4-dinitrobenzene with reduced glutathione.
Function	Can catalyze the production of LTC4 from LTA4 and reduced glutathione. Can catalyze the conjugation of 1-chloro-2, 4-dinitrobenzene with reduced glutathione.
Subcellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Microsome membrane, Multi-pass membrane protein
Protein Families	MAPEG family
Tissue Specificity	Liver, spleen, skeletal muscle, heart, adrenals, pancreas, prostate, testis, fetal liver, and fetal spleen. Very low expression in lung, brain, placenta and bone marrow.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern